General Information

  • ID:  hor003530
  • Uniprot ID:  O43612
  • Protein name:  Orexin-B
  • Gene name:  HCRT
  • Organism:  Homo sapiens (Human)
  • Family:  Orexin family
  • Source:  Human
  • Expression:  Abundantly expressed in subthalamic nucleus but undetectable in other brain regions tested (hypothalamus was not tested) and in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Disease:  Diseases associated with HCRT include Narcolepsy 1 and Narcolepsy.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0031771 type 1 orexin receptor binding; GO:0031772 type 2 orexin receptor binding
  • GO BP:  GO:0001659 temperature homeostasis; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007205 protein kinase C-activating G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007631 feeding behavior; GO:0008156 negative regulation of DNA replication; GO:0030431 sleep; GO:0042594 response to starvation; GO:0042755 eating behavior; GO:0043267 negative regulation of potassium ion transport; GO:0046928 regulation of neurotransmitter secretion; GO:0051928 positive regulation of calcium ion transport; GO:0051970 negative regulation of transmission of nerve impulse; GO:0051971 positive regulation of transmission of nerve impulse; GO:0060079 excitatory postsynaptic potential; GO:0120162 positive regulation of cold-induced thermogenesis
  • GO CC:  GO:0005576 extracellular region; GO:0005783 endoplasmic reticulum; GO:0005791 rough endoplasmic reticulum; GO:0008021 synaptic vesicle; GO:0030141 secretory granule; GO:0031410 cytoplasmic vesicle; GO:0045202 synapse; GO:0048471 perinuclear region of cytoplasm; GO:0098794 postsynapse

Sequence Information

  • Sequence:  RSGPPGLQGRLQRLLQASGNHAAGILTM
  • Length:  28
  • Propeptide:  MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI
  • Signal peptide:  MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAA
  • Modification:  T28 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  play a significant role in the regulation of food intake and sleep-wakefulness, possibly by coordinating the complex behavioral and physiologic responses of these complementary homeostatic functions. A broader role in the homeostatic regulation of energy metabolism, autonomic function, hormonal balance and the regulation of body fluids, is also suggested.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  HCRTR1, HCRTR2
  • Target Unid:  O43613, O43614
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  1cq0(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1cq0.pdbhor003530_AF2.pdbhor003530_ESM.pdb

Physical Information

Mass: 338215 Formula: C123H211N43O36S
Absent amino acids: CDEFKVWY Common amino acids: GL
pI: 12.8 Basic residues: 4
Polar residues: 9 Hydrophobic residues: 9
Hydrophobicity: -26.43 Boman Index: -4005
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 94.29
Instability Index: 6795.71 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA